Scaffold Ga0082029_1071485

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0082029_1071485

Scaffold Ga0082029_1071485

Overview

Basic Information
Taxon OID	3300006169 Open in IMG/M
Scaffold ID	Ga0082029_1071485 Open in IMG/M
Source Dataset Name	Termite nest microbial communities from Madurai, India
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	BGI Tech Solutions Co., Ltd.
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1117
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest → Termite Nest Microbial Communities From Madurai, India

Source Dataset Sampling Location
Location Name	MKU,India
Coordinates	Lat. (^o)	9.941418	Long. (^o)	78.008896	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004628	Metagenome / Metatranscriptome	430	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0082029_10714852	F004628	AGGAG	MTRNLLYRCLAITLLVLPCLFVTGPAFAQRNREVPVRELLSVPGKVVSEARSNRPTTELKLTGYRVEEIKLPRQLNVEVRGQQVAVDRAWRVTVQGGPFAVRAMPAVLWIDDEIVGYGIENETLSQITAITFDGSLIREGGVLSLSYGEDKEQRARFSQRLRLTREGGNQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.