NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0082029_1070384

Scaffold Ga0082029_1070384


Overview

Basic Information
Taxon OID3300006169 Open in IMG/M
Scaffold IDGa0082029_1070384 Open in IMG/M
Source Dataset NameTermite nest microbial communities from Madurai, India
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBGI Tech Solutions Co., Ltd.
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)794
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest → Termite Nest Microbial Communities From Madurai, India

Source Dataset Sampling Location
Location NameMKU,India
CoordinatesLat. (o)9.941418Long. (o)78.008896Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007445Metagenome / Metatranscriptome351Y

Sequences

Protein IDFamilyRBSSequence
Ga0082029_10703841F007445GGAGMVEQPTVKCPSCESVLRAADESGLVNVLQQHLYEEHALEMPRERVRENVYAQLKDFDGYNARPISGV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.