Scaffold Ga0082029_1035570

Overview

Basic Information

• Taxon OID: 3300006169
• Scaffold ID: Ga0082029_1035570
• Source Dataset Name: Termite nest microbial communities from Madurai, India
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: BGI Tech Solutions Co., Ltd.
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 753
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest → Termite Nest Microbial Communities From Madurai, India

Source Dataset Sampling Location

• Location Name: MKU,India
• Coordinates
  • Lat. (^o): 9.941418
  • Long. (^o): 78.008896

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099838	Metagenome / Metatranscriptome	103	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0082029_10355701	F099838	GGAGG	MSETMPEKEIPEAWVGQRVRVVHAHSASTHTDGVLLGVGDRGIVVEGGELVRFYPWTSVGSIEKAHEEGTEDPGVQARRA