Scaffold Ga0082047_11642

Overview

Basic Information

• Taxon OID: 3300006159
• Scaffold ID: Ga0082047_11642
• Source Dataset Name: Marine microbial communities from the Red Sea brine-pool interfase layer Discovery Deep
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: King Abdullah University of Science and Technology
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 501
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Red Sea Brine-Pools

Source Dataset Sampling Location

• Location Name: Red Sea
• Coordinates
  • Lat. (^o): 21.28639
  • Long. (^o): 38.28722
  • Depth (m): 2038

Associated Families

Family	Category	Number of Sequences	3D Structure?
F106033	Metagenome	100	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0082047_116421	F106033	N/A	SKYALLECNMDPDHDDVEISDHPDFVHHDSGAQFSWDGWTSVVFISDLRHDGDFGLKLKSTDNDIIPFRARGDTAERILSEVTAIYFNNTGTAGTNYLLLEGY*