Scaffold Ga0082047_10951

Overview

Basic Information

• Taxon OID: 3300006159
• Scaffold ID: Ga0082047_10951
• Source Dataset Name: Marine microbial communities from the Red Sea brine-pool interfase layer Discovery Deep
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: King Abdullah University of Science and Technology
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 726
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Red Sea Brine-Pools

Source Dataset Sampling Location

• Location Name: Red Sea
• Coordinates
  • Lat. (^o): 21.28639
  • Long. (^o): 38.28722
  • Depth (m): 2038

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068204	Metagenome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0082047_109511	F068204	AGGAGG	VRLAYKILIGLVIAFVALFGVPAGIALAKGKSEALRGLIQTLKYILKAHKETIGAMVKAYVKF