Basic Information | |
---|---|
Taxon OID | 3300006159 Open in IMG/M |
Scaffold ID | Ga0082047_10664 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Red Sea brine-pool interfase layer Discovery Deep |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | King Abdullah University of Science and Technology |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 866 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Red Sea Brine-Pools |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Red Sea | |||||||
Coordinates | Lat. (o) | 21.28639 | Long. (o) | 38.28722 | Alt. (m) | Depth (m) | 2038 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F068204 | Metagenome | 125 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0082047_106642 | F068204 | AGG | VRLAYKILIALGIAFVALFGVPAGIALAKGKSEALRGLIQTLKYILKAHKATVGAMIDAYKQFLGSL* |
⦗Top⦘ |