Scaffold Ga0080701_1000577

Overview

Basic Information

• Taxon OID: 3300006138
• Scaffold ID: Ga0080701_1000577
• Source Dataset Name: Intestinal microbial communities from Inflammed Rag1 mice from UTSWMC, Dallas, Texas, USA - t14_683M_control - microbial_metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Texas Southwestern Medical Center
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 36247
• Total Scaffold Genes: 49
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 36 (73.47%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Unclassified → Unclassified → Mouse Feces → Intestinal Microbial Communities From Inflammed Rag1 Mice From Utswmc, Dallas, Texas, Usa

Source Dataset Sampling Location

• Location Name: UTSWMC, Dallas, Texas, USA
• Coordinates
  • Lat. (^o): 32.73
  • Long. (^o): -96.97

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066905	Metagenome	126	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0080701_100057724	F066905	N/A	VNIHSILYENLKEVDIMPEEQRNCGCNQNNNNGCGCCGVLGNLFGGNGCCGDSEILFFIIIFLLLFTNFGCCGR*