NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0007828_1006051

Scaffold Ga0007828_1006051


Overview

Basic Information
Taxon OID3300006128 Open in IMG/M
Scaffold IDGa0007828_1006051 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2609
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040465Metagenome / Metatranscriptome161N
F081269Metagenome / Metatranscriptome114N

Sequences

Protein IDFamilyRBSSequence
Ga0007828_10060513F081269N/AMEALPVAVSGSLYKSALTMIKELKKLVIKLTREGVSCSPSVIQMFDETKRWFMERIRVHFADSQKRYLQWRWRAAEKMFLQFKDGKPLTSVAATSVVNVAASPTRRPRKRVKVAAPAPSNLTVIPE*
Ga0007828_10060515F040465N/ALSYAQDIWNREHSPDEERLDDWLLVMEEIVGIIGYTYHSIFQLLESTNVNNNCLLEALRALYIFAMAEVNVAKRKRTSS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.