NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0007873_1030114

Scaffold Ga0007873_1030114


Overview

Basic Information
Taxon OID3300006124 Open in IMG/M
Scaffold IDGa0007873_1030114 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH26May08
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)905
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039951Metagenome162Y

Sequences

Protein IDFamilyRBSSequence
Ga0007873_10301141F039951N/AQDLKKVEKNKAPINSNFLLTINTNQQYKDTDANLDNDIEIFEETINDILNNVDQYINIAPGDLWDDKTIRDVQIDYTIERGTIKHQLHIHIFFKIQHFTKIQLNYQKIKDKIKKDLGLNNIYLNNRLVRNSGAQNILEYLDKYK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.