Scaffold Ga0007871_1003344

Overview

Basic Information

• Taxon OID: 3300006110
• Scaffold ID: Ga0007871_1003344
• Source Dataset Name: Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Jun09
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3535
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Crystal Bog, Wisconsin, USA
• Coordinates
  • Lat. (^o): 46.0072
  • Long. (^o): -89.6063

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035159	Metagenome	172	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0007871_10033444	F035159	GGCGG	MFQTAFQVNAFQNDAFQIVITPTNLKNGGDDALWTREELKRLKGIQKKLRLAEAKRIAALKADQKARKQTITDLVNPKPVAKTQQSNIQSNQEVSVDIPSNLANIDRYIANLEQQQQDLQNAVLIRSAKLRLEQELAILEAKRQAELDDEEALL