Scaffold Ga0082019_1045558

Overview

Basic Information

• Taxon OID: 3300006093
• Scaffold ID: Ga0082019_1045558
• Source Dataset Name: Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP189
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Major University, Chile
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 793
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Eastern Tropical South Pacific Oxygen Minumum Zone, Cruise Nbp1315, 2013

Source Dataset Sampling Location

• Location Name: Eastern Topical South Pacific
• Coordinates
  • Lat. (^o): -13.71
  • Long. (^o): -81.389
  • Depth (m): 115

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042376	Metagenome / Metatranscriptome	158	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0082019_10455582	F042376	N/A	MRKLINKWFKNEVKTYQGTMLRYFYAPVTGFALVLAIVCGFVIGFDEVWRYWRVAALNLSL*