| Basic Information | |
|---|---|
| Taxon OID | 3300006093 Open in IMG/M |
| Scaffold ID | Ga0082019_1025997 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP189 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Major University, Chile |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1103 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Eastern Tropical South Pacific Oxygen Minumum Zone, Cruise Nbp1315, 2013 |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Eastern Topical South Pacific | |||||||
| Coordinates | Lat. (o) | -13.71 | Long. (o) | -81.389 | Alt. (m) | Depth (m) | 115 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003827 | Metagenome / Metatranscriptome | 466 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0082019_10259973 | F003827 | GAG | MAVGRWADWQVRQIAENMAEKRPKREWFDGHHEDYFTSLKSWSHITTRNLYSMELEERQMIIFIHHLGMEHVGVETFDPQ |
| ⦗Top⦘ |