| Basic Information | |
|---|---|
| Taxon OID | 3300006092 Open in IMG/M |
| Scaffold ID | Ga0082021_1154080 Open in IMG/M |
| Source Dataset Name | Activated sludge microbial communities from wastewater treatment plant in Ulu Pandan, Singapore |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Nanyang Technological University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 11188 |
| Total Scaffold Genes | 13 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (53.85%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Treatment Plant → Activated Sludge Microbial Communities From Wastewater Treatment Plant In Ulu Pandan, Singapore |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ulu Pandan, Singapore | |||||||
| Coordinates | Lat. (o) | 1.3315 | Long. (o) | 103.7543 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F094043 | Metagenome / Metatranscriptome | 106 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0082021_115408010 | F094043 | GGAGG | MARTIQTIAGLAVCSLCLSTPFVSGVAVLGAAEDSITLKGCLVKGDGDGAGYLLTNTSAAPAWQRAEDTRVQPGAVGTSGGYESVFYWLDGDNDLKKNIGHLVEIKGDLKGDLKDGEIKLERKDRWTELTVKSDDRTMKANVPNASVFAAPNEGKEQKNRILVRKVDVDHVSMLAATCDDAR* |
| ⦗Top⦘ |