Scaffold Ga0082021_1031263

Overview

Basic Information

• Taxon OID: 3300006092
• Scaffold ID: Ga0082021_1031263
• Source Dataset Name: Activated sludge microbial communities from wastewater treatment plant in Ulu Pandan, Singapore
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Nanyang Technological University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 20698
• Total Scaffold Genes: 24
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 18 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Treatment Plant → Activated Sludge Microbial Communities From Wastewater Treatment Plant In Ulu Pandan, Singapore

Source Dataset Sampling Location

• Location Name: Ulu Pandan, Singapore
• Coordinates
  • Lat. (^o): 1.3315
  • Long. (^o): 103.7543

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070253	Metagenome / Metatranscriptome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0082021_103126313	F070253	N/A	MGRTPFWTRTNLACVACAWLLVLITAPAASAQATTVDAALAFYGMSGAYCFRVAPLGTALAEESEWTVMVLTSASNHRNTFRIRSVDPGDSGLKGSGLQRVGGIVNEVWKFDGTREEFFERFAKGIRDRELRARVVKVVPTGLATMSSIRERAELYLKFADKGTKVSFDEVPDLTAEQFLTYLDFVPD*