Scaffold Ga0082018_1066183

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0082018_1066183

Scaffold Ga0082018_1066183

Overview

Basic Information
Taxon OID	3300006091 Open in IMG/M
Scaffold ID	Ga0082018_1066183 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP125
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Major University, Chile
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	649
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Eastern Tropical South Pacific Oxygen Minumum Zone, Cruise Nbp1315, 2013

Source Dataset Sampling Location
Location Name	Eastern Topical South Pacific
Coordinates	Lat. (^o)	-13.71	Long. (^o)	-81.389	Alt. (m)		Depth (m)	405
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050431	Metagenome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0082018_10661831	F050431	N/A	MRYAVGAFLLYTIGYLGGDIIIASIWVGIAYGFIDLMKQGRI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.