NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0082018_1039850

Scaffold Ga0082018_1039850


Overview

Basic Information
Taxon OID3300006091 Open in IMG/M
Scaffold IDGa0082018_1039850 Open in IMG/M
Source Dataset NameMarine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP125
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMajor University, Chile
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)852
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Eastern Tropical South Pacific Oxygen Minumum Zone, Cruise Nbp1315, 2013

Source Dataset Sampling Location
Location NameEastern Topical South Pacific
CoordinatesLat. (o)-13.71Long. (o)-81.389Alt. (m)Depth (m)405
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046421Metagenome / Metatranscriptome151N

Sequences

Protein IDFamilyRBSSequence
Ga0082018_10398502F046421AGGAGMAKIGQPPNKGSATAAGPNMNPPPYAEGKPKVVKEPKGGKSYSNIDGIINACVSASGKNGFSRG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.