| Basic Information | |
|---|---|
| Taxon OID | 3300006091 Open in IMG/M |
| Scaffold ID | Ga0082018_1035458 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP125 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Major University, Chile |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 905 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Eastern Tropical South Pacific Oxygen Minumum Zone, Cruise Nbp1315, 2013 |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Eastern Topical South Pacific | |||||||
| Coordinates | Lat. (o) | -13.71 | Long. (o) | -81.389 | Alt. (m) | Depth (m) | 405 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F090256 | Metagenome | 108 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0082018_10354581 | F090256 | AGGAGG | VQSNTSIETSTVKVGDIGEQLVEEFFPKAERTDDWFDSEKDGTIKEKTYEVKTFRLNNKDQGFWVDSSQFRKLDNVDILYFVKIPESLEEGATIYECMDHTSEDAYESFKLGPIKQMRCYFLDNCKKITNIRDERTDTLYHNSVAMSKHKRF |
| ⦗Top⦘ |