| Basic Information | |
|---|---|
| Taxon OID | 3300006080 Open in IMG/M |
| Scaffold ID | Ga0081602_1357090 Open in IMG/M |
| Source Dataset Name | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid E |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Max Planck Institute for Plant Breeding Research |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 529 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluid → Microbial Communities In Diffuse Hydrothermal Fluids Of Manus Basin, Bismarck Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Manus Basin, Bismarck Sea | |||||||
| Coordinates | Lat. (o) | -3.720639 | Long. (o) | 151.675313 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005524 | Metagenome | 398 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0081602_13570901 | F005524 | N/A | DIGDKVLHFGTGSVGTIIDSSYEVETPFQQMCVQWEDDLAPHKDSWERRNDLSMVETPAYDFSICK* |
| ⦗Top⦘ |