Scaffold Ga0081594_1055433

Overview

Basic Information

• Taxon OID: 3300006077
• Scaffold ID: Ga0081594_1055433
• Source Dataset Name: Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid B
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Max Planck Institute for Plant Breeding Research
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2154
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium GWB1_59_5 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluid → Microbial Communities In Diffuse Hydrothermal Fluids Of Manus Basin, Bismarck Sea

Source Dataset Sampling Location

• Location Name: Manus Basin, Bismarck Sea
• Coordinates
  • Lat. (^o): -3.7992608
  • Long. (^o): 152.1013353

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029561	Metagenome / Metatranscriptome	188	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0081594_10554332	F029561	AGG	MSNQVDKLTDPEFAHTSILSRGQLQMIEDDPAKMETLARLMGAVNLDNLFRHMQNPTINPATRLEFQKMLNKMGKLEPDGKDVVGASGPQVIINITRAKDREEEAITIEGTTLEA*