| Basic Information | |
|---|---|
| Taxon OID | 3300006076 Open in IMG/M |
| Scaffold ID | Ga0081592_1081420 Open in IMG/M |
| Source Dataset Name | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid A |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Max Planck Institute for Plant Breeding Research |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1343 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluids → Microbial Communities In Diffuse Hydrothermal Fluids Of Manus Basin, Bismarck Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Manus Basin, Bismarck Sea | |||||||
| Coordinates | Lat. (o) | -3.7999163 | Long. (o) | 152.1008595 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001034 | Metagenome / Metatranscriptome | 798 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0081592_10814203 | F001034 | AGGA | VTLLSTDTYEDAQYQNDAPIGEQPPIPAGVHNIELSWDRSRGYMRIIIGGTHSWWFKEYLGKAQVIGTDNGRGRITLRAMARIDGETLTMYRPPEAPAHGMVEGLERKRTHNRLCYRRSSQDWRLRDERLPWNDPDALKFVTTYVGDLSAEWNGSDQIAHIYHNGSAVIDDQHICHLYDPDLIYG* |
| ⦗Top⦘ |