Scaffold Ga0081592_1013834

Overview

Basic Information

• Taxon OID: 3300006076
• Scaffold ID: Ga0081592_1013834
• Source Dataset Name: Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid A
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Max Planck Institute for Plant Breeding Research
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4641
• Total Scaffold Genes: 11
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (72.73%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluids → Microbial Communities In Diffuse Hydrothermal Fluids Of Manus Basin, Bismarck Sea

Source Dataset Sampling Location

• Location Name: Manus Basin, Bismarck Sea
• Coordinates
  • Lat. (^o): -3.7999163
  • Long. (^o): 152.1008595

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081441	Metagenome / Metatranscriptome	114	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0081592_10138349	F081441	AGGA	MVLNSREKFIAFYSMFLTTHIGLGVNPAELDRDGMGHIFNAVLETVRKSVCPDVSEDEVKAIAEDFNIEMFKIRTVLDEALRSQRLGERV*