Scaffold Ga0081428_135430

Overview

Basic Information

• Taxon OID: 3300006068
• Scaffold ID: Ga0081428_135430
• Source Dataset Name: Hotspring Microbial Communities from Mammoth Norris Corridor Bijah Spring, Yellowstone National Park, Wyoming, USA ? Sample 4, Mini-Metagenomics
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Stanford University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1148
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hotsprings → Mini-Metagenome - Microbial Communities From The Yellowstone National Park

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.761133
  • Long. (^o): -110.7309
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088948	Metagenome / Metatranscriptome	109	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0081428_1354302	F088948	N/A	MPGYLFYYHRQTPTIKLPNLHEILNNSGNPSIISYKRVTDFGIVPFLFVEGTPANPHYDLVAKVREHLKKQNVEPGTIKVVTYQRDELYQYSQSRIPWHYIGPKLVKQKISIDQINKKLDKITLDKAEVVFLESSKAGKELLGYLTEKDVDAVEMLKFFLDRTSQKLKIEVPIKDYDLLYDMLYDVYEYYIWYGIRSEIDNFHTLIENFYRYYLLNKLPKVVGLYWLDTYYDPSTLVTQIQP*