Basic Information | |
---|---|
Taxon OID | 3300006068 Open in IMG/M |
Scaffold ID | Ga0081428_113022 Open in IMG/M |
Source Dataset Name | Hotspring Microbial Communities from Mammoth Norris Corridor Bijah Spring, Yellowstone National Park, Wyoming, USA ? Sample 4, Mini-Metagenomics |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Stanford University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4162 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hotsprings → Mini-Metagenome - Microbial Communities From The Yellowstone National Park |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Yellowstone National Park, Wyoming, USA | |||||||
Coordinates | Lat. (o) | 44.761133 | Long. (o) | -110.7309 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F075803 | Metagenome / Metatranscriptome | 118 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0081428_1130223 | F075803 | N/A | MTSLKALSAFPSPAFMRFRTSASEAPNITLWPFLHNLHKPPLHKKLHFRHTPKKAFVVSDFDTTPPRMTLLSSLSGIFWSQGAALERRGTPFAPKGATFLFVYSYITPHWACRFWLAAHLCLHPVPRSGVLIEPYLGKPHPYLICGSTLGTFPILNPKKEPTLPKCSFDSTLPEKNQKGYAYA* |
⦗Top⦘ |