NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075029_100005866

Scaffold Ga0075029_100005866


Overview

Basic Information
Taxon OID3300006052 Open in IMG/M
Scaffold IDGa0075029_100005866 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6770
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking

Source Dataset Sampling Location
Location NameUSA: Pennsylvania, Clearfield County
CoordinatesLat. (o)41.170727Long. (o)-78.4726Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002492Metagenome / Metatranscriptome554Y
F016467Metagenome / Metatranscriptome247Y

Sequences

Protein IDFamilyRBSSequence
Ga0075029_1000058668F016467GAGMINKSMEQTSPTPKNLQRAFEHAVRDIYEVGLSGKISQYRTPIAQRLGVKAPSSPAHAEKQALADAAKALAQLWKISPHLIR*
Ga0075029_1000058669F002492GAGGMDIHVSPIPSSTPGWHSLYHDALFEQDKQKVPEKIACAEKAILNRMKELFNTSGDHIEEDLVLDDALYALRALRTCVQHELLAA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.