Basic Information | |
---|---|
Taxon OID | 3300006050 Open in IMG/M |
Scaffold ID | Ga0075028_100000094 Open in IMG/M |
Source Dataset Name | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 30607 |
Total Scaffold Genes | 30 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 26 (86.67%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Pennsylvania, Clearfield County | |||||||
Coordinates | Lat. (o) | 41.170727 | Long. (o) | -78.4726 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F007854 | Metagenome / Metatranscriptome | 343 | Y |
F017111 | Metagenome | 242 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0075028_10000009418 | F007854 | GGAG | MNTLIANQYGRIQGEVGGSGPVLAVAAQTPRRDSVQLQTRLDSVEQQLYLLAILRAVERRIEQFQLRDSSTGDSQAREPESPFEGTICSEGDLFNANGASKNKIYGRFAQFLIYEQVDQGRLRVFFAVRDDAKRVARFDLHPGEVQALCALVRRSLFDREQIDLLLRDDLSLTAALQATGQGLRFDVQTPLWRSEFSMTKGNELATLAVFTRRAIHQEKVVPLHFGDEGNQFSLRKRADGQVLAEFQHQESVERVPLSTLQLYELEILAQYALHRVFEPSEVSISNQVPPHSATAAQIA* |
Ga0075028_1000000949 | F017111 | AGGAG | MSDTTVIAGDEIRDAKLELGDYCEFYSHLAMQARRASRVALLACSVALVAMVSGILAQLRPPILLRVQDGNVSSLNGSGVEVAQTVAQQQPDDAEKLSFVSSFLDRFVNIDPVTVKRSTTMALNQMTNTLRQHILAQLNEQHFVDTVRDNNVTATLAVKSAELVSGDPYTAVVFGQKRITTLINGQENKKELLVKYMIRLAPVPHAASNGWSGLEVADYKEEVLQQ* |
⦗Top⦘ |