Scaffold Ga0075365_10011961

Overview

Basic Information

• Taxon OID: 3300006038
• Scaffold ID: Ga0075365_10011961
• Source Dataset Name: Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5127
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere → Populus Root And Rhizosphere Microbial Communities From Tennessee, Usa

Source Dataset Sampling Location

• Location Name: USA: Tennessee
• Coordinates
  • Lat. (^o): 35.8443
  • Long. (^o): -83.9607
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003891	Metagenome / Metatranscriptome	463	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0075365_100119614	F003891	GAGG	MRPSNRLLPLLLLIPLIAACSSSESQLEAIAAQLSEAVNRCVIDVRDKTSKYETSPNCRSLGKIAQQYVDAGGLKESAPCRADRIAEAARARAWMALAVSKSGDPGLTIW*