Scaffold Ga0066371_10143896

Overview

Basic Information

• Taxon OID: 3300006024
• Scaffold ID: Ga0066371_10143896
• Source Dataset Name: Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 730
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Cercozoa → Imbricatea → Silicofilosea → Euglyphida → Paulinellidae → Paulinella → Paulinella micropora (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location

• Location Name: Southern Atlantic ocean
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004842	Metagenome / Metatranscriptome	421	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066371_101438962	F004842	N/A	VPPNKVAKDKGKRTLDGEIFLRSHQPSTNGNSDATTGVLGTIPEIGAIKNANKAIKLLGVLILSEEISSLTLSRAPLLNKAEETANKPIKVIRDGLPKPDNAFSGVSTPVAINIPTHNKPVNSGAIVFFIKRIIDKNKTTTVINAS*