Scaffold Ga0066371_10065662

Overview

Basic Information

• Taxon OID: 3300006024
• Scaffold ID: Ga0066371_10065662
• Source Dataset Name: Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1059
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location

• Location Name: Southern Atlantic ocean
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070008	Metagenome	123	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0066371_100656622	F070008	GAGG	MKNAVIFMLSIGLSIIVGIIVGTNKAEERLVEYDKKYEKIEKDVSTFVDVSNPKTIRMYTKELRDILDNMSRLSKIIDKGEEIDIALGKIMDGIEQLEDQWDVTLSNDIKMKETIEVVNNHIKEVDSRFQSQLGSILDKELETIDLKIAKQFDQIENDLRDIRNMLTQIENSKVGKKIFN