NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0081606_1315395

Scaffold Ga0081606_1315395


Overview

Basic Information
Taxon OID3300006001 Open in IMG/M
Scaffold IDGa0081606_1315395 Open in IMG/M
Source Dataset NameEarthworm egg capsule microbial community from the University of Washington, USA - E. fetida Yelm (SPADES assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)675
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Annelida → Reproductive System → Egg Capsule → Unclassified → Earthworm Egg Capsule → Earthworm Egg Capsule Microbial Community From The University Of Washington, Usa

Source Dataset Sampling Location
Location NameUniversity of Washington, USA
CoordinatesLat. (o)47.0Long. (o)-122.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F077889Metagenome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0081606_13153951F077889N/AMSNSVNFYEFNGFITINIEVHELVYLYSFLVDRILVFIVPRATVRRH*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.