Scaffold Ga0081606_1182832

Overview

Basic Information

• Taxon OID: 3300006001
• Scaffold ID: Ga0081606_1182832
• Source Dataset Name: Earthworm egg capsule microbial community from the University of Washington, USA - E. fetida Yelm (SPADES assembly)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1111
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Annelida → Reproductive System → Egg Capsule → Unclassified → Earthworm Egg Capsule → Earthworm Egg Capsule Microbial Community From The University Of Washington, Usa

Source Dataset Sampling Location

• Location Name: University of Washington, USA
• Coordinates
  • Lat. (^o): 47.0
  • Long. (^o): -122.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003519	Metagenome	481	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0081606_11828323	F003519	N/A	MLERYHKLQPKPKTIAELKAALQLIWDDMPQEPINKAVKDFNKRLKVCVQVNGGHFEHFM