| Basic Information | |
|---|---|
| Taxon OID | 3300006001 Open in IMG/M |
| Scaffold ID | Ga0081606_1165947 Open in IMG/M |
| Source Dataset Name | Earthworm egg capsule microbial community from the University of Washington, USA - E. fetida Yelm (SPADES assembly) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1187 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Annelida → Reproductive System → Egg Capsule → Unclassified → Earthworm Egg Capsule → Earthworm Egg Capsule Microbial Community From The University Of Washington, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | University of Washington, USA | |||||||
| Coordinates | Lat. (o) | 47.0 | Long. (o) | -122.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F077889 | Metagenome | 117 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0081606_11659471 | F077889 | N/A | MSNSVNFYEFIGFITFNIEVHESLGYVYSFLVGRIFVSNVPRAIVRIKPIT* |
| ⦗Top⦘ |