Scaffold Ga0081606_1090984

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0081606_1090984

Scaffold Ga0081606_1090984

Overview

Basic Information
Taxon OID	3300006001 Open in IMG/M
Scaffold ID	Ga0081606_1090984 Open in IMG/M
Source Dataset Name	Earthworm egg capsule microbial community from the University of Washington, USA - E. fetida Yelm (SPADES assembly)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1689
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Annelida → Reproductive System → Egg Capsule → Unclassified → Earthworm Egg Capsule → Earthworm Egg Capsule Microbial Community From The University Of Washington, Usa

Source Dataset Sampling Location
Location Name	University of Washington, USA
Coordinates	Lat. (^o)	47.0	Long. (^o)	-122.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054628	Metagenome	139	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0081606_10909841	F054628	N/A	MRLINERGRFVQSIVDAVIGQWRRRLSACVRGAGHTIEHQA*SFSY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.