Scaffold Ga0056123_1378539

Overview

Basic Information

• Taxon OID: 3300006000
• Scaffold ID: Ga0056123_1378539
• Source Dataset Name: Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 3 HERON ISLAND
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 519
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: Max Planck institute for Marine Microbiology, Germany
• Coordinates
  • Lat. (^o): 51.321602
  • Long. (^o): 12.394572

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007256	Metagenome	354	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0056123_13785391	F007256	N/A	ADEVYVLRGKERDQVEVYDVINYCLQRCLTVPNIGGVRDMTSCEHYHCVYIANYSGECVHRLDVQGASTRWFVYDKPRGLSVNAAHNLLVTCRVVRKLKEFSSHGDLLRELTLPGDVINPRHAIQAPNGEFIVCHGDHDDAVHRVT*