| Basic Information | |
|---|---|
| Taxon OID | 3300005995 Open in IMG/M |
| Scaffold ID | Ga0066790_10008382 Open in IMG/M |
| Source Dataset Name | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4568 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil → Permafrost Soil Microbial Communities From The Arctic, To Analyse Light Accelerated Degradation Of Dissolved Organic Matter (Dom) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Alaska, USA | |||||||
| Coordinates | Lat. (o) | 68.6135 | Long. (o) | -149.3144 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F027250 | Metagenome / Metatranscriptome | 195 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0066790_100083822 | F027250 | AGG | MRCRFLLALMLLMVSETASVAVESGAVPLTIVRAEVKTHDRVVYWLVNTPIYHEDPYFEVAVRSSGTVIVGEHEPESAHELMPEYWKPGTLVQGRVDRHHLFLKRLNGTEVRFVITRRTKVSSE* |
| ⦗Top⦘ |