Scaffold Ga0080027_10023069

Overview

Basic Information

• Taxon OID: 3300005993
• Scaffold ID: Ga0080027_10023069
• Source Dataset Name: Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2218
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil → Permafrost Soil Microbial Communities From The Arctic, To Analyse Light Accelerated Degradation Of Dissolved Organic Matter (Dom)

Source Dataset Sampling Location

• Location Name: Alaska, USA
• Coordinates
  • Lat. (^o): 68.6139
  • Long. (^o): -149.3145
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081654	Metagenome / Metatranscriptome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0080027_100230692	F081654	GAG	VLLVLLIATLSFPLQSQTPEPAKPVEAKGTEWKSVAFAIVRFNDEAPQSWNIYHTSKRGVLLVKLWKRYLLVNIPEGQVFDIDPHTVKAQGDAVEWSTSDTPTEPLEISDWRVRDVGPVERVRFRLGKNPGHILELQLPLLPGGKPAY*