NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0073921_1043357

Scaffold Ga0073921_1043357


Overview

Basic Information
Taxon OID3300005990 Open in IMG/M
Scaffold IDGa0073921_1043357 Open in IMG/M
Source Dataset NameGroundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_30-Apr-14
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)834
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Unclassified → Sand → Groundwater Microbial Communities From The Columbia River, Washington, Usa

Source Dataset Sampling Location
Location NameUSA: Columbia River, Washington
CoordinatesLat. (o)46.372Long. (o)-119.272Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051728Metagenome / Metatranscriptome143Y

Sequences

Protein IDFamilyRBSSequence
Ga0073921_10433571F051728N/AMPKTSLKKWKKYVEGCKHKDFFDNVRSLKVKTCPEKIVIRTTRDSSQRILGGGNKIKGQLQTLINGLSNIPKKALRRWAKTVQDTKDKKLFDGARSAKLQLSLVRILRRTMKEAHERVKGLMFASPQVKGIIKRMDGILKRKPKEAFDRWRKYVQAVNNSEILDGIKSQKLLVCLSKV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.