NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075158_10301246

Scaffold Ga0075158_10301246


Overview

Basic Information
Taxon OID3300005987 Open in IMG/M
Scaffold IDGa0075158_10301246 Open in IMG/M
Source Dataset NameWastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)909
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent → Wastewater Effluent Complex Algal Communities From Wisconsin, To Seasonally Profile Nutrient Transformation And Carbon Sequestration

Source Dataset Sampling Location
Location NameMilwaukee, Wisconsin, USA
CoordinatesLat. (o)43.023Long. (o)-87.895Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004905Metagenome / Metatranscriptome419Y

Sequences

Protein IDFamilyRBSSequence
Ga0075158_103012461F004905N/AMRRKVNFQQSEYVQDGEVVCFGVSEHFFEEARHKWSEKAQKDLKVLGTWFNRGNFEDVATRPVYRSDFNWTSYHTRAQLRVLLGLAFIRELPIRNFYIRCWIAYAYIIFFVIRGIGRGMSIARPIVMYNNAIHAKSLANYPDLYWWNLGRRLPKATPTPDVHREWQTRQMPVYHQYHKTAYRYRNRKPRYVPWDGTMNQPVMPYLHDDGTDVINGTFKRNCNSSPHLH*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.