NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0081540_1000331

Scaffold Ga0081540_1000331


Overview

Basic Information
Taxon OID3300005983 Open in IMG/M
Scaffold IDGa0081540_1000331 Open in IMG/M
Source Dataset NameTabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)48663
Total Scaffold Genes43 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)32 (74.42%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere → Tabebuia Heterophylla Rhizosphere Microbial Communities From The University Of Puerto Rico

Source Dataset Sampling Location
Location NameUniversity of Puerto Rico, San Juan, Puerto Rico
CoordinatesLat. (o)18.402889Long. (o)-66.050054Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041273Metagenome / Metatranscriptome160Y
F060361Metagenome / Metatranscriptome133Y
F064166Metagenome / Metatranscriptome129Y
F076566Metagenome / Metatranscriptome118Y

Sequences

Protein IDFamilyRBSSequence
Ga0081540_100033118F076566N/AMGAISNALQDLESALRSLVDENTVLKNQLQRIVEQAGQMFDGHAARGRPARAGRGRDGAPKKRGRAFKFTDDQATDFRRQVEGGKSAASLAKDLKVSLPTMYNTLKRAGWSGRGGRGRGRPPRAARTRDGAPKKRGRSFKFTEDQAVEFKKQVEGGKSAASLAKELKVSLPTMYNTLKRAGWKGRK*
Ga0081540_100033131F064166GAGMTRRKGVLPVIQMTVVAASSRPRFTSRGELDAAFAPIAGIDFLCGACDRVVLARVAPKFALEHSFPCPHCGALNEAP*
Ga0081540_100033133F060361GAGMSTLKRILRELTQEIERLSDRNEVLERRLTSITGALQGAVRVPRDGSGRVGRTSRRGGRRGAPPKFSDAQAVQLRREYEKGATSAQLAKKYKAALPTILGTLRRAGASLRRGRPPKRK*
Ga0081540_10003315F041273GGAGGMGWAARIGWGFLGLGVAGCGDGVGAGPVRPGPPVVSIADRCTVEGVRIEVENGVLGGFSGESPCAYSGRFVTVWRRTYEERWGPVPLESWTVRIRTPELVDARGHSGLTWYDERILELSQLHFELLPHELHHARLGETSSDHHGWCADFVPWELERHIQDERAALGCGS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.