Scaffold Ga0056129_1126673

Overview

Basic Information

• Taxon OID: 3300005978
• Scaffold ID: Ga0056129_1126673
• Source Dataset Name: Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1383
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Panpulmonata → Sacoglossa → Placobranchoidea → Plakobranchidae → Elysia → Elysia chlorotica (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: Max Planck institute for Marine Microbiology, Germany
• Coordinates
  • Lat. (^o): 51.321602
  • Long. (^o): 12.394572

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060648	Metagenome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0056129_11266734	F060648	N/A	MTTFTHQLLQEKHQRQKSDNASANIPAAVLRAVAVLRVGYAEVIFIQPDGKLDTM*