Scaffold Ga0081474_119948

Overview

Basic Information

• Taxon OID: 3300005977
• Scaffold ID: Ga0081474_119948
• Source Dataset Name: Ferrous microbial mat communities from One Hundred Spring Plain, Yellowstone National Park, USA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 4230
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Ferrous Microbial Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: One Hundred Spring Plain, Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.7330426
  • Long. (^o): -110.7089928

Associated Families

Family	Category	Number of Sequences	3D Structure?
F101502	Metagenome	102	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0081474_1199483	F101502	N/A	MSQVSKAPVIAFTVALGVGLGIVVIGASGPLKPGVGAVIVLLASLACVPAYAWLRHPGLIIVIELGVGVFLTIIIANWLHGISPLTSLEWYYNALRVLITPLARLTP*