Scaffold Ga0081474_117719

Overview

Basic Information

• Taxon OID: 3300005977
• Scaffold ID: Ga0081474_117719
• Source Dataset Name: Ferrous microbial mat communities from One Hundred Spring Plain, Yellowstone National Park, USA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 4326
• Total Scaffold Genes: 11
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 9 (81.82%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Marsarchaeota → Candidatus Marsarchaeota group 1 → Candidatus Marsarchaeota G1 archaeon BE_D (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Ferrous Microbial Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: One Hundred Spring Plain, Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.7330426
  • Long. (^o): -110.7089928

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092367	Metagenome / Metatranscriptome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0081474_11771911	F092367	N/A	MSENNVISVKQHFEKIDATVARIITMLNRDLELGLQDDVVVALKLLLYLLHVVEEKATTKEEKEVVRQVKSRIAEYVTGE*