Scaffold Ga0081478_167978

Overview

Basic Information

• Taxon OID: 3300005966
• Scaffold ID: Ga0081478_167978
• Source Dataset Name: Hot spring and microbial mat streamer communities from Octopus Spring Streamers, Yellowstone National Park, USA - T=80-84
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 22630
• Total Scaffold Genes: 49
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 29 (59.18%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Adnaviria → Zilligvirae → Taleaviricota → Tokiviricetes → Primavirales → Tristromaviridae → Alphatristromavirus → Alphatristromavirus PFV2 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring And Microbial Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: Octopus Spring Streamers, Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.5340836
  • Long. (^o): -110.7978895

Associated Families

Family	Category	Number of Sequences	3D Structure?
F100050	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0081478_1679783	F100050	N/A	MGITVFPMDAVVRYVIAAVLAVAGGYVGYHFVPSVPFGVVGNVLFVGALFGLVAGLFRFTGFFGNVVNAFLLSFPLWFLLPGEWFIIWTGGNVGYAFGNVFGQLAVLSTMRKIEAKAL*