Scaffold Ga0081478_158397

Overview

Basic Information

• Taxon OID: 3300005966
• Scaffold ID: Ga0081478_158397
• Source Dataset Name: Hot spring and microbial mat streamer communities from Octopus Spring Streamers, Yellowstone National Park, USA - T=80-84
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 7104
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → unclassified Pyrobaculum → Pyrobaculum sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring And Microbial Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: Octopus Spring Streamers, Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.5340836
  • Long. (^o): -110.7978895

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013155	Metagenome / Metatranscriptome	274	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0081478_1583975	F013155	N/A	MEIQIILATVAAANLAVTIWLLRLLLPIWRTLKKVMNAVDQFDFDKLAKQFLGNETPVAESVAVKTTEKKEEGYREISIIRTYKKPLSPKEVSENIVRQMAQEMQ*