Scaffold Ga0081534_106127

Overview

Basic Information

• Taxon OID: 3300005959
• Scaffold ID: Ga0081534_106127
• Source Dataset Name: Hypoxic/sulfidic aquatic microbial communities from Monarch Geyser, Yellowstone National Park, USA - MG (SPADES assembly)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2222
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Hypoxic/Sulfidic Aquatic → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: Monarch Geyser, Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.376
  • Long. (^o): -110.69

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079395	Metagenome / Metatranscriptome	116	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0081534_1061276	F079395	GAGG	MSIRPSEEFELTPIMRKTISAMLEGVIVALTRLGYLEQDRANELIEKLNTDALNVGQLRLLTDVVIAWFSVSGYFSEAE