| Basic Information | |
|---|---|
| Taxon OID | 3300005958 Open in IMG/M |
| Scaffold ID | Ga0081473_135700 Open in IMG/M |
| Source Dataset Name | Hypoxic/sulfidic aquatic microbial communities from Cistern Spring, Yellowstone National Park, USA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1767 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Unclassified → Hypoxic/Sulfidic Aquatic → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Yellowstone National Park, Wyoming | |||||||
| Coordinates | Lat. (o) | 44.7230812 | Long. (o) | -110.7040247 | Alt. (m) | Depth (m) | 9 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008606 | Metagenome / Metatranscriptome | 330 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0081473_1357003 | F008606 | GGAGG | VAEARDPVSDPEGRSYDKLVELSGQVNELRGQVISLAERVTRLEEENRWLRQEIAEIKGTVNEVRRNSVAILASILTVLVTVVIGLIAH* |
| ⦗Top⦘ |