| Basic Information | |
|---|---|
| Taxon OID | 3300005957 Open in IMG/M |
| Scaffold ID | Ga0081535_100267 Open in IMG/M |
| Source Dataset Name | Hypersaline microbial mat communities from Hot Lake, Washington, USA - Section #3 (SPADES assembly) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 44124 |
| Total Scaffold Genes | 74 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 67 (90.54%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Hot Lake, Oroville, Washington, USA | |||||||
| Coordinates | Lat. (o) | 48.973481 | Long. (o) | -119.476345 | Alt. (m) | Depth (m) | .35 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F101126 | Metagenome / Metatranscriptome | 102 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0081535_10026748 | F101126 | AGGAG | MPKFIVDLWLDGYETEEEMEEACEEFIYDQLNMTASSVKIQKIEDDE* |
| ⦗Top⦘ |