NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066380_10038452

Scaffold Ga0066380_10038452


Overview

Basic Information
Taxon OID3300005948 Open in IMG/M
Scaffold IDGa0066380_10038452 Open in IMG/M
Source Dataset NameSeawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_O2min_ad_571m_LV
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1323
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NameSouthern Atlantic ocean
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016882Metagenome / Metatranscriptome244Y
F057678Metagenome / Metatranscriptome136N
F061281Metagenome / Metatranscriptome132N

Sequences

Protein IDFamilyRBSSequence
Ga0066380_100384522F016882N/AMGYYVSRVKIATDTPKGVKWITERYLVNAVSVGHAEQLVHEDFKDSGSEFEVKSVSASQIHKVIGTTKKI*
Ga0066380_100384523F057678N/AMVEYEVNDRVVFGYNNVNEVAVVTNVRRHKNNITGYDIRSEKGSGYIIVQVDANLTTRQYNKRVEYPLINSKLTAAWIGSDSDTNLFAKEGVGHTRQNFSKSMPIYLDGESGGGIQHFEKHNDLLFPTQGPRSF*
Ga0066380_100384524F061281N/AMDKFQKKVLKQFPDAYPETSDHGIRIVSGENFIAKEFYVPDTQDESKAWEYAAMACKLTQNFNRAHPLRMDLTDIESKLARINRRKKKGRRVK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.