| Basic Information | |
|---|---|
| Taxon OID | 3300005937 Open in IMG/M |
| Scaffold ID | Ga0081455_10657631 Open in IMG/M |
| Source Dataset Name | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 674 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere → Tabebuia Heterophylla Rhizosphere Microbial Communities From The University Of Puerto Rico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | University of Puerto Rico, San Juan, Puerto Rico | |||||||
| Coordinates | Lat. (o) | 18.402889 | Long. (o) | -66.050054 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F031606 | Metagenome / Metatranscriptome | 182 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0081455_106576312 | F031606 | N/A | IDPRGAGWEKNLREQFERRRKQGFEYVELDNPDAYSIKDVIGAIELAASYGLKVIAKNPGLMGGGATAYVAHPNVHGIIVERGAGNAGDMDKLRRKAGKPTLPTWFVAFGSGRSWAGSVASSAKNYRNMGVTYSSAGEYGNAIDILPPT* |
| ⦗Top⦘ |