NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0081455_10018834

Scaffold Ga0081455_10018834


Overview

Basic Information
Taxon OID3300005937 Open in IMG/M
Scaffold IDGa0081455_10018834 Open in IMG/M
Source Dataset NameTabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6549
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (45.45%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere → Tabebuia Heterophylla Rhizosphere Microbial Communities From The University Of Puerto Rico

Source Dataset Sampling Location
Location NameUniversity of Puerto Rico, San Juan, Puerto Rico
CoordinatesLat. (o)18.402889Long. (o)-66.050054Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000466Metagenome / Metatranscriptome1105Y
F044630Metagenome / Metatranscriptome154N

Sequences

Protein IDFamilyRBSSequence
Ga0081455_100188343F000466AGGAGMALTYVTNSESWKSWKSRKKLPYQGVVKRDWVPTGRIDFATNLDGNGADADQPSEFKLLVEERRIVESIAGNENLEIQWRLATLKEAKAVVTQYHKYLTDHSLIKTVFDETMSLPPPKKGQGNSSSQSLAS*
Ga0081455_100188345F044630AGGAGGMRFAALAALGVLVVLPAEALQQRQYASLTPTCDNDGRCTTFHATAPMTASRDSSPEIKTTAPIPAARPQLRPLDANGNSTGGLVMSRKTGARAHVGVAHAARFQAYIDDIENNHGARVLFMGGIRPGRCSPASEHPCGKALDVCQLARGVVDRRCNLPNRVALGRIAAAHGLFEGGRWCNSDYGHAQIDVTAAACGERGVRVVQQRHREETISIQQNMALGALH*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.