Scaffold Ga0075125_10170462

Overview

Basic Information

• Taxon OID: 3300005935
• Scaffold ID: Ga0075125_10170462
• Source Dataset Name: Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKN
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 907
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_41_22 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Ace Lake, Antarctica
• Coordinates
  • Lat. (^o): -68.4725
  • Long. (^o): 78.188

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058677	Metagenome	134	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0075125_101704622	F058677	AGGAGG	MHQINAEELFQIIGEQLMTIRKQNQEIMRLQTEVTKL